PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00360.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 333aa    MW: 37581.1 Da    PI: 6.6325
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00360.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-171562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ + + +G g W+t +++ g++R++k+c++rw +yl
  Rsa1.0_00360.1_g00018.1 15 KGAWTPEEDQKLISYLNNHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62
                             79********************************************97 PP

2Myb_DNA-binding52.41.2e-1668112147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +T++E+  ++ +++++G++ W++Iar ++ gRt++++k++w+++
  Rsa1.0_00360.1_g00018.1  68 RGEFTEDEERSIISLHALHGNK-WAAIARGLP-GRTDNEIKNYWNTH 112
                              899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8171062IPR017930Myb domain
SuperFamilySSF466891.5E-2812109IPR009057Homeodomain-like
SMARTSM007171.8E-121464IPR001005SANT/Myb domain
PfamPF002491.7E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231669IPR009057Homeodomain-like
CDDcd001673.35E-91762No hitNo description
PROSITE profilePS5129425.33463117IPR017930Myb domain
SMARTSM007172.9E-1667115IPR001005SANT/Myb domain
PfamPF002491.9E-1568112IPR001005SANT/Myb domain
CDDcd001677.18E-1270113No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2570118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009625Biological Processresponse to insect
GO:0009651Biological Processresponse to salt stress
GO:0009682Biological Processinduced systemic resistance
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009759Biological Processindole glucosinolate biosynthetic process
GO:0052544Biological Processdefense response by callose deposition in cell wall
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MVRTPCCKAE LGLKKGAWTP EEDQKLISYL NNHGEGGWRT LPEKAGLKRC GKSCRLRWAN  60
YLRPDIKRGE FTEDEERSII SLHALHGNKW AAIARGLPGR TDNEIKNYWN THIKKRLIKK  120
GVYPVTHESL ISGASKSENL PEILDKQNVI QTTITSNDDL GNNEKVKNED KKSRLSSARF  180
LNRVANRFGK KINQSVLSEI IGSGGPLTTT NTTTSVTLDS ESDKSTSFSF TPTSYLLNQM  240
TVNGDGKATS PPYMFSDSSV NDPLMYCSVD NVGFSGFLND QHFIMLEESR VENTEFMNEL  300
MRFLQEDVNN DVEATPVYEH QGDFKEIDNY FFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28131175108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00147DAPTransfer from AT1G18570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842980.0FJ584298.1 Brassica rapa subsp. pekinensis MYB domain protein 51-3 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646695.10.0PREDICTED: transcription factor MYB51-like
RefseqXP_013723281.10.0PREDICTED: transcription factor MYB51-like isoform X1
SwissprotO497821e-151MYB51_ARATH; Transcription factor MYB51
TrEMBLM4EA590.0M4EA59_BRARP; Uncharacterized protein
STRINGBra025666.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.11e-151myb domain protein 51